PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400005647
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 222aa    MW: 24554 Da    PI: 9.6858
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400005647genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.77.8e-19139172134
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                           C++C++ kTp+WR gp g+ktLCnaCG++y++ +
  PGSC0003DMP400005647 139 CTHCQVQKTPQWRAGPLGPKTLCNACGVRYKSGR 172
                           *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577163.8E-15132195No hitNo description
SMARTSM004012.6E-14133183IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.308133169IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.108.9E-15136171IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.87E-12138186No hitNo description
PfamPF003201.4E-16139172IPR000679Zinc finger, GATA-type
PROSITE patternPS003440139164IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MENLEWLSQF VDDTPSEFSL LCPAESFKDK TGDFTEFRSE PVVRPVVKKM RVPCFPLPFP  60
VKPRSKRSRP AGRTWSFPSS TVSGDSSSPT SSSYGSSPFP SGFFTNPVYD GDLFCSVEKP  120
PLKKPKKNPS AETGSGRRCT HCQVQKTPQW RAGPLGPKTL CNACGVRYKS GRLYPEYRPA  180
CSPTFSLEVH SNSHRKVLEM RRKKETGEVI DSGLASMIST C*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006362004.11e-161PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH573e-50GATA5_ARATH; GATA transcription factor 5
TrEMBLM0ZU331e-161M0ZU33_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000081121e-161(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.14e-41GATA transcription factor 2
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]